PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00016.1.g01920.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 838aa    MW: 93103.4 Da    PI: 4.889
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00016.1.g01920.1.sm.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.42.2e-153878748
                                    HHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                 Myb_DNA-binding  7 eEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                    eEde++++ v++lG++ W+tIa+ ++ gR +kqc++rw+++l
  Zjn_sc00016.1.g01920.1.sm.mkhc 38 EEDEIIIQMVNKLGPKKWSTIAQALP-GRIGKQCRERWHNHL 78
                                    9*************************.*************97 PP

2Myb_DNA-binding51.23e-1684126145
                                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
                 Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                                     + +WT+eE+ +l++a++ +G++ W+  ++ ++ gRt++ +k++w+
  Zjn_sc00016.1.g01920.1.sm.mkhc  84 KEAWTQEEEIRLIHAHQTYGNK-WAELSKFLP-GRTDNAIKNHWH 126
                                     579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007178.9E-123180IPR001005SANT/Myb domain
PROSITE profilePS5129415.1143278IPR017930Myb domain
CDDcd001678.44E-133878No hitNo description
PfamPF139212.2E-153895No hitNo description
Gene3DG3DSA:1.10.10.603.5E-233885IPR009057Homeodomain-like
SuperFamilySSF466899.39E-2958135IPR009057Homeodomain-like
PROSITE profilePS5129425.11579133IPR017930Myb domain
SMARTSM007174.5E-1583131IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-2286133IPR009057Homeodomain-like
CDDcd001671.12E-1186126No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0032875Biological Processregulation of DNA endoreduplication
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 838 aa     Download sequence    Send to blast
EEKGSPFGLR DWRFGAALRR VVAARLCRRW SSPGCAGEED EIIIQMVNKL GPKKWSTIAQ  60
ALPGRIGKQC RERWHNHLNP GINKEAWTQE EEIRLIHAHQ TYGNKWAELS KFLPGRTDNA  120
IKNHWHSSVK KKIDSYRASG LLAQFQGIMH VEYPAVSLNI DSSSAMTQQH SEDSGFNVGE  180
VEGSTELSQS SLAKASCSQE EQIEPSLDSH VHAHNSLCQE PCYTNADNVA SVLPEMQHIA  240
DSDEDTHLQK FSQTTELPFD IDKEPKNSMS TDMQTSSELA GQLQYTQTMY NSENHGGSFN  300
PYAVDPDVPI SMSHNIPKYG HNVDVMCEVG ISCDKYLESE PWQGVSFQTV ACGSEAENTF  360
SAPLYPLQTS NSSTMIDTGS DGIPNINYES SNFPFFHQDL EGNSCHIASV DPNQQSYVSS  420
EDDKNRAPEP MENLPESEKK QLVDIEPSRQ PTVTFGKETL STHCDTVECE RNDVEALCYE  480
PPCFPSFEVP FVRCDLISSS DLPEFSPFGI RELMRSSLNF PTPLRLWSSP PRDGSPDAVL  540
KSAAKSFSST PSIMKKRPRE LSSPCADIID EKNLTTEQDC GNLDISCKII RRSCLGTADE  600
SFDLVSPGEQ TGLQQKKLKL FEENKENVKE ITDQDEIEGN VRGSHLVKGK RCSTVDSDFT  660
SNSHPPGILT QSNADNLNTP KHEYEYMNIM ADTPSVKRGL ESPSAWKSPL FTAFQGAYFM  720
SPAARAFDAL GLVKQINEQS ADALEEAHEV LASGSTKNRH SKGKWDKENT KSSLWKNGLI  780
ISKLSSEVMA EARVLDFNDC STPARKKDDT NQSSKSYDSP PMAIGAEKFG ICIERNVQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C5e-403813310105C-Myb DNA-Binding Domain
1msf_C5e-403813310105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00505DAPTransfer from AT5G11510Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960646.10.0PREDICTED: myb-related protein 3R-1
RefseqXP_004960647.10.0PREDICTED: myb-related protein 3R-1
RefseqXP_004960645.10.0PREDICTED: myb-related protein 3R-1
TrEMBLK3Z3V00.0K3Z3V0_SETIT; Uncharacterized protein
STRINGSi021218m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.23e-56myb domain protein 3r-4